PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G403100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 360aa    MW: 41287 Da    PI: 5.0209
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G403100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+lv+++ + G g+W+++++  g+ R++k+c++rw +yl
  Aqcoe5G403100.1.p 14 KGLWSPEEDEKLVNYISRNGIGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding47.34.9e-1567110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg ++++E+  ++++++ lG++ W+ I+++++ gRt++++k++w++
  Aqcoe5G403100.1.p  67 RGMFSQQEENTIINLHEILGNR-WAQISAHLP-GRTDNEIKNFWNS 110
                        788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.119965IPR017930Myb domain
SuperFamilySSF466891.24E-2812108IPR009057Homeodomain-like
SMARTSM007172.0E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001673.05E-101761No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.20866116IPR017930Myb domain
SMARTSM007179.4E-1466114IPR001005SANT/Myb domain
PfamPF002495.9E-1467111IPR001005SANT/Myb domain
CDDcd001672.58E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLVNYIS RNGIGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEENTIIN LHEILGNRWA QISAHLPGRT DNEIKNFWNS CLKKKLRQQG  120
IDPATHKPLS QMEIMQNGRE EKYLQPSQPS REIEQEMLSI NNSCYFDTTG YDEASNVQFL  180
TKPVFDPFPI FESQLSFDQV GSNSNLLLQY HQNFRPSSDK SQMEANDQEF KFASMPNLTS  240
CDYSTVTETD VSDNSSSRIN TLFLDESKES CSNSCNFNSQ AASFQMNNMV ANAVFAFDQE  300
TKLDSVFQYQ LNGIKCEDVQ MSSWQEEQQQ RHHPGDFNTL PSLFSEDLTA ASFDLFEQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248622.11e-151PREDICTED: myb-related protein Hv33-like
TrEMBLH9XUF61e-152H9XUF6_9MAGN; R2R3-MYB transcription factor MYB6
STRINGVIT_17s0000g09080.t011e-140(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-81myb domain protein 86